A20494
SPATA5 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A20494
- Additional Names:
- AFG2|EHLMRS|NEDHSB|SPAF|SPATA5
- Application:
- ELISA, WB
- Molecular Weight:
- 98kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LELSLQLSQLDLEDTQIPTSRSTPYKPIDDRITNKASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLTE
- Uniprot:
- Q8NB90
- Synonyms:
- AFG2;ATPase family gene 2 homolog;ATPase family protein 2 homolog;EHLMRS;SPAF;spermatogenesis associated factor SPAF;spermatogenesis-associated factor protein;spermatogenesis-associated protein 5
- Extra Details:
- This gene encodes a member of the ATPase associated with diverse activities family, whose members are defined by a highly conserved ATPase domain. Members of this family participate in diverse cellular processes that include membrane fusion, DNA replication, microtubule severing, and protein degradation. The protein encoded by this gene has a putative mitochondrial targeting sequence and has been proposed to function in maintenance of mitochondrial function and integrity during mouse spermatogenesis. Allelic variants in this gene have been associated with epilepsy, hearing loss, and cognitive disability syndrome. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice





