A20491
TM4SF19 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A20491
- Additional Names:
- OCTM4|TM4SF19
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 22kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LLGRHAMLGTGLWGGGLMVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSL
- Uniprot:
- Q96DZ7
- Synonyms:
- OCTM4;osteoclast maturation-associated gene 4 protein;tetraspan membrane protein OCTM4;transmembrane 4 L6 family member 19
- Extra Details:
- The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice



