A20474
S100A8 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A20474
- Additional Names:
- 60B8Ag|B8Ag|Caga|CFAg|CP-10|MRP8|p8|S100A8
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 11kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
- Uniprot:
- P27005
- Synonyms:
- 60B8A;60B8AG;AI323541;B8A;B8Ag;Ca;CAGA;calgranulin A;calgranulin-A;calprotectin L1L subunit;CFA;CFAG;CGLA;chemotactic cytokine CP-10;chemotactic S100 protein;CP-1;CP-10;cystic fibrosis antigen;L1Ag;leukocyte L1 complex light chain;MA387;MIF;migration inhibitory factor-related protein 8;MR;MRP-8;MRP8;NIF;p;P8;pro-inflammatory S100 cytokine;protein S100-A8;S100 calcium-binding protein A8;S100-A8;urinary stone protein band A
- Extra Details:
- Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Acts upstream of or within astrocyte development and positive regulation of peptide secretion. Predicted to be located in cytosol and intermediate filament cytoskeleton. Predicted to be active in extracellular space. Is expressed in several structures, including bone marrow; extraembryonic component; female reproductive system; and liver. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A8 (S100 calcium binding protein A8).
- Shipping Conditions:
- Blue Ice





