SSR2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20462
Additional Names:: HSD25|SSR2|TLAP|TRAP-BETA|TRAPB
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSP
Uniprot:: P43308
Synonyms:: HSD25;signal sequence receptor subunit beta;signal sequence receptor, beta (translocon-associated protein beta);SSR-beta;TLAP;translocon-associated protein beta;translocon-associated protein subunit beta;TRAP-BETA;TRAPB
Extra Details:: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein (alpha-SSR or SSR1) and a 22-kD glycoprotein (beta-SSR or SSR2). The human beta-signal sequence receptor gene (SSR2) maps to chromosome bands 1q21-q23.