A20460
Syntrophin alpha 1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20460
- Additional Names:
- dJ1187J4.5|LQT12|SNT1|Syntrophin alpha 1|TACIP1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 59kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTV
- Uniprot:
- Q13424
- Synonyms:
- 59 kDa dystrophin-associated protein A1 acidic component 1;acidic alpha 1 syntrophin;alpha-1-syntrophin;dJ1187J4.5;dystrophin-associated protein A1, 59kDa, acidic component;LQT12;pro-TGF-alpha cytoplasmic domain-interacting protein 1;SNT1;syntrophin-1;TACIP1
- Extra Details:
- Syntrophins are cytoplasmic peripheral membrane scaffold proteins that are components of the dystrophin-associated protein complex. This gene is a member of the syntrophin gene family and encodes the most common syntrophin isoform found in cardiac tissues. The N-terminal PDZ domain of this syntrophin protein interacts with the C-terminus of the pore-forming alpha subunit (SCN5A) of the cardiac sodium channel Nav1.5. This protein also associates cardiac sodium channels with the nitric oxide synthase-PMCA4b (plasma membrane Ca-ATPase subtype 4b) complex in cardiomyocytes. This gene is a susceptibility locus for Long-QT syndrome (LQT) - an inherited disorder associated with sudden cardiac death from arrhythmia - and sudden infant death syndrome (SIDS). This protein also associates with dystrophin and dystrophin-related proteins at the neuromuscular junction and alters intracellular calcium ion levels in muscle tissue.
- Shipping Conditions:
- Blue Ice