NDUFB8 Rabbit polyclonal antibody

Size

POA

SKU:: A20457
Additional Names:: ASHI|CI-ASHI|MC1DN32|NDUFB8
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 20kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
Uniprot:: O95169
Synonyms:: ASHI;CI-ASHI;complex I ASHI subunit;complex I-ASHI;MC1DN32;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial;NADH-ubiquinone oxidoreductase ASHI subunit;NADH:ubiquinone oxidoreductase ASHI subunit
Extra Details:: Involved in mitochondrial respiratory chain complex I assembly. Located in endoplasmic reticulum and mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency 32. Biomarker of Alzheimer's disease and Parkinson's disease.