HOXB6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20451
Additional Names:: Hox-2.2|HOX2|HOX2B|HOXB6|HU-2
Application:: ELISA, WB
Molecular Weight:: 25kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQ
Uniprot:: P17509
Synonyms:: homeo box 2B;homeo box B6;homeobox protein Hox-2.2;homeobox protein Hox-2B;homeobox protein Hox-B6;homeobox protein Hu-2;Hox-2.2;HOX2;HOX2B;HU-2
Extra Details:: This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer.