A20447
Rev-erb beta/NR1D2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20447
- Additional Names:
- BD73|EAR-1R|Rev-erb beta/NR1D2|REVERBB|REVERBbeta|RVR
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
- Uniprot:
- Q14995
- Synonyms:
- BD73;EAR-1R;nuclear receptor Rev-ErbA beta variant 1;nuclear receptor Rev-ErbA beta variant 2;nuclear receptor subfamily 1 group D member 2;orphan nuclear hormone receptor BD73;rev-erb alpha-related receptor;rev-erb-beta;rev-erba-alpha-related receptor;REVERBB;REVERBbeta;RVR;V-erbA-related protein 1-related
- Extra Details:
- This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.
- Shipping Conditions:
- Blue Ice