A20416
TIGAR Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A20416
- Additional Names:
- C12orf5|FR2BP|TIGAR
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGA
- Uniprot:
- Q9NQ88
- Synonyms:
- C12orf5;FR2BP;fructose-2,6-bisphosphatase TIGAR;fructose-2,6-bisphosphate 2-phosphatase;probable fructose-2,6-bisphosphatase TIGAR;TP53-induced glycolysis and apoptosis regulator;TP53-induced glycolysis regulatory phosphatase;transactivated by NS3TP2 protein
- Extra Details:
- This gene is regulated as part of the p53 tumor suppressor pathway and encodes a protein with sequence similarity to the bisphosphate domain of the glycolytic enzyme that degrades fructose-2,6-bisphosphate. The protein functions by blocking glycolysis and directing the pathway into the pentose phosphate shunt. Expression of this protein also protects cells from DNA damaging reactive oxygen species and provides some protection from DNA damage-induced apoptosis. The 12p13.32 region that includes this gene is paralogous to the 11q13.3 region.
- Shipping Conditions:
- Blue Ice







