A20372
HLA-DQB1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20372
- Additional Names:
- CELIAC1|HLA-DQB|HLA-DQB1|IDDM1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RDSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRV
- Uniprot:
- P01920
- Synonyms:
- CELIAC1;HLA class II histocompatibility antigen, DQ beta 1 chain;HLA-DQB;IDDM1;MHC class II antigen DQB1;MHC class II antigen HLA-DQ-beta-1;MHC class II DQ beta chain;MHC class II HLA-DQ beta glycoprotein
- Extra Details:
- HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice