CD70 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2032
Additional Names:: CD27-L|CD27L|CD27LG|CD70|LPFS3|TNFSF7|TNLG8A
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 54 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPT
Uniprot:: P32970
Synonyms:: CD27 ligand;CD27-L;CD27L;CD27LG;CD70 antigen;Ki-24 antigen;LPFS3;surface antigen CD70;TNFSF7;TNLG8A;tumor necrosis factor ligand 8A;tumor necrosis factor ligand superfamily member 7
Extra Details:: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.