A20307
SARS-CoV-2 ORF7a Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20307
- Application:
- ELISA, WB
- Molecular Weight:
- 17kDa
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS
- Uniprot:
- P0DTC7
- Synonyms:
- Accessory protein 7a;GU280_gp07;ORF7a protein;Protein U122;Protein X4
- Extra Details:
- Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF7a encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF7a protein is thought to be a type I transmembrane protein.
- Shipping Conditions:
- Blue Ice