A20285
RPS6KA1/RPS6KA2/RPS6KA3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20285
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 83kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAA
- Uniprot:
- P51812, Q15349, Q15418
- Synonyms:
- 90 kDa ribosomal protein S6 kinase 1;90 kDa ribosomal protein S6 kinase 2;90 kDa ribosomal protein S6 kinase 3;CLS;dJ590P13.1 (ribosomal protein S6 kinase, 90kD, polypeptide 1);epididymis secretory sperm binding protein;HU-1;HU-2;HU-3;insulin-stimulated protein kinase 1;ISPK-1;MAP kinase-activated protein kinase 1a;MAP kinase-activated protein kinase 1b;MAP kinase-activated protein kinase 1c;MAPK-activated protein kinase 1a;MAPK-activated protein kinase 1b;MAPK-activated protein kinase 1c;MAPKAP kinase 1a;MAPKAP kinase 1b;MAPKAPK-1a;MAPKAPK-1b;MAPKAPK1;MAPKAPK1A;MAPKAPK1B;MAPKAPK1C;mitogen-activated protein kinase-activated protein kinase 1C;MRX19;p90-RSK 1;p90-RSK 3;p90-RSK2;p90-RSK3;p90Rsk;p90RSK1;p90RSK2;p90S6K;pp90RSK2;pp90RSK3;ribosomal protein S6 kinase alpha-1;ribosomal protein S6 kinase alpha-2;ribosomal protein S6 kinase alpha-3;ribosomal protein S6 kinase, 90kDa, polypeptide 1;ribosomal protein S6 kinase, 90kDa, polypeptide 2;ribosomal protein S6 kinase, 90kDa, polypeptide 3;ribosomal S6 kinase 1;ribosomal S6 kinase 2;ribosomal S6 kinase 3;RSK;RSK-1;RSK-2;RSK1;RSK2;RSK3;S6K-alpha;S6K-alpha 1;S6K-alpha-3;S6K-alpha2;S6K-alpha3;XLID19
- Extra Details:
- This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Shipping Conditions:
- Blue Ice