Tspan18 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20275
Additional Names:: 2610042G18Rik|6720430O15|Tspan18
Application:: ELISA, WB
Molecular Weight:: 28kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GVNGPEDFKLASVFRLLTLDTEEVPKACCRREPQTRDGVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVFAMCLFRGIQ
Uniprot:: Q80WR1
Synonyms:: 2610042G18Rik;6720430O15;BB226562;tetraspanin-18;tspan-18
Extra Details:: Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; immune system; and integumental system. Orthologous to human TSPAN18 (tetraspanin 18).