[KO Validated] Edf1 Rabbit polyclonal antibody

Size

POA

SKU:: A20274
Additional Names:: 0610008L11Rik|f1|MBF1
Application:: ELISA, WB
Molecular Weight:: 17kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPKAK
Uniprot:: Q9JMG1
Synonyms:: 0610008L11Rik;AA409425;CFAP280;EDF-1;endothelial differentiation-related factor 1;hypothetical protein 1-9;MBF1;multiprotein bridging factor 1;multiprotein-bridging factor 1
Extra Details:: Predicted to enable TFIID-class transcription factor complex binding activity and transcription coactivator activity. Predicted to be involved in positive regulation of DNA binding activity. Predicted to act upstream of or within cell differentiation. Predicted to be located in cytosol; nucleolus; and nucleoplasm. Predicted to be active in nucleus. Is expressed in several structures, including central nervous system; genitourinary system; heart; liver; and retina. Orthologous to human EDF1 (endothelial differentiation related factor 1).