A20259
GALNT7 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20259
- Additional Names:
- GALNAC-T7|GalNAcT7|GALNT7
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- PRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRPG
- Uniprot:
- Q86SF2
- Synonyms:
- GALNAC-T7;GalNAcT7;N-acetylgalactosaminyltransferase 7;polypeptide GalNAc transferase 7;pp-GaNTase 7;protein-UDP acetylgalactosaminyltransferase 7;UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7;UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7)
- Extra Details:
- This gene encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation.
- Shipping Conditions:
- Blue Ice