[KD Validated] CDX2 Rabbit monoclonal antibody

Size

POA

SKU:: A20222
Additional Names:: CDX-3|CDX2/AS|CDX3|X2
Application:: ELISA, WB
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS
Uniprot:: Q99626
Synonyms:: caudal type homeobox transcription factor 2;caudal-type homeobox protein 2;CDX-3;CDX2/AS;CDX3;homeobox protein CDX-2;homeobox protein miniCDX2
Extra Details:: This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.