A20181
RAD54L Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A20181
- Additional Names:
- hHR54|HR54|hRAD54|RAD54A|RAD54L
- Application:
- ELISA, WB
- Molecular Weight:
- 84kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR
- Uniprot:
- Q92698
- Synonyms:
- DNA repair and recombination protein RAD54-like;hHR54;HR54;hRAD54;RAD54 homolog;RAD54A
- Extra Details:
- The protein encoded by this gene belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination. Alternative splicing results in multiple transcript variants encoding the same protein.
- Shipping Conditions:
- Blue Ice

