Stella Rabbit polyclonal antibody

Size

£152.00

SKU:: A20176
Additional Names:: 2410075G02Rik|PCG7|PGC7|Stella
Application:: ELISA, WB
Molecular Weight:: 17kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEEPSEKVDPMKDPETPQKKDEEDALDDTDVLQPETLVKVMKKLTLNPGVKRSARRRSLRNRIAAVPVENKSEKIRREVQSAFPKRRVRTLLSVLKDPIAKMRRLVRIEQRQKRLEGNEFERDSEPFRCLCTFCHYQRWDPSENAKIGKN
Uniprot:: Q8QZY3
Synonyms:: 2410075G02Rik;compaction-associated protein 1;developmental pluripotency-associated protein 3;PCG7;PGC;PGC7;primordial germ cell 7;primordial germ cell protein 7;st;Stella
Extra Details:: Enables methylated histone binding activity. Involved in negative regulation of DNA demethylation; protection of DNA demethylation of female pronucleus; and regulation of genetic imprinting. Acts upstream of or within embryonic cleavage. Located in cytoplasm; female pronucleus; and male pronucleus. Is expressed in several structures, including central nervous system; early conceptus; gonad; hindgut diverticulum; and primordial germ cell. Orthologous to human DPPA3 (developmental pluripotency associated 3).