PCNT Rabbit polyclonal antibody

Size

£152.00

SKU:: A20161
Additional Names:: KEN|MOPD2|PCN|PCNT|PCNT2|PCNTB|PCTN2|SCKL4
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 251kDa/378kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GEKREDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTISDHPAEQRGMFT
Uniprot:: O95613
Synonyms:: KEN;kendrin;MOPD2;PCN;PCNT2;PCNTB;PCTN2;pericentrin;pericentrin-2;pericentrin-380;pericentrin-B;SCKL4
Extra Details:: The protein encoded by this gene binds to calmodulin and is expressed in the centrosome. It is an integral component of the pericentriolar material (PCM). The protein contains a series of coiled-coil domains and a highly conserved PCM targeting motif called the PACT domain near its C-terminus. The protein interacts with the microtubule nucleation component gamma-tubulin and is likely important to normal functioning of the centrosomes, cytoskeleton, and cell-cycle progression. Mutations in this gene cause Seckel syndrome-4 and microcephalic osteodysplastic primordial dwarfism type II. Two transcript variants encoding different isoforms have been found for this gene.