HOXB2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20158
Additional Names:: Hox-2.8|HOX2|HOX2H|HOXB2|K8
Application:: ELISA, WB
Molecular Weight:: 35kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EQTFPSLQPGASTLQRPRSQKRAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGG
Uniprot:: P14652
Synonyms:: homeo box 2H;homeo box B2;homeobox protein Hox-2.8;homeobox protein Hox-2H;homeobox protein Hox-B2;Hox-2.8;HOX2;HOX2H;K8;K8 home protein
Extra Details:: This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer.