A2014
CBLB Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2014
- Additional Names:
- Cbl-b|CBLB|Nbla00127|RNF56
- Application:
- ELISA, WB
- Molecular Weight:
- 125kDa/130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNVEVARSILREFAFPPPVSPRLNL
- Uniprot:
- Q13191
- Synonyms:
- Cas-Br-M (murine) ecotropic retroviral transforming sequence b;casitas B-lineage lymphoma proto-oncogene b;Cbl proto-oncogene B, E3 ubiquitin protein ligase;Cbl proto-oncogene, E3 ubiquitin protein ligase B;Cbl-b;E3 ubiquitin-protein ligase CBL-B;Nbla00127;RING finger protein 56;RING-type E3 ubiquitin transferase CBL-B;RNF56;SH3-binding protein CBL-B;signal transduction protein CBL-B
- Extra Details:
- This gene encodes an E3 ubiquitin-protein ligase which promotes proteosome-mediated protein degradation by transferring ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate. The encoded protein is involved in the regulation of immune response by limiting T-cell receptor, B-cell receptor, and high affinity immunoglobulin epsilon receptor activation. Studies in mouse suggest that this gene is involved in antifungal host defense and that its inhibition leads to increased fungal killing. Manipulation of this gene may be beneficial in implementing immunotherapies for a variety of conditions, including cancer, autoimmune diseases, allergies, and infections.
- Shipping Conditions:
- Blue Ice



