ANGPTL4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2011
Additional Names:: ANGPTL4|ARP4|FIAF|HARP|HFARP|NL2|PGAR|pp1158|TGQTL|UNQ171
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 45-50kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQ
Uniprot:: Q9BY76
Synonyms:: Angiopoietin-like protein 4;angiopoietin-related protein 4;ARP4;fasting-induced adipose factor;FIAF;HARP;hepatic angiopoietin-related protein;hepatic fibrinogen/angiopoietin-related protein;HFARP;NL2;peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein;PGAR;pp1158;PPARG angiopoietin related protein;TGQTL;UNQ171
Extra Details:: This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4.

Shipping Conditions:: Blue Ice