A2004
PTP4A3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2004
- Additional Names:
- PRL-3|PRL-R|PRL3|PTP4A3
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
- Uniprot:
- O75365
- Synonyms:
- phosphatase of regenerating liver 3;potentially prenylated protein tyrosine phosphatase;PRL-3;PRL-R;PRL3;protein tyrosine phosphatase type IVA 3;protein tyrosine phosphatase type IVA, member 3;Protein-tyrosine phosphatase 4a3;protein-tyrosine phosphatase of regenerating liver 3
- Extra Details:
- This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice