HIF3A Rabbit polyclonal antibody

Size

£152.00

SKU:: A20020
Additional Names:: bHLHe17|HIF-3A|HIF3-alpha-1|HIF3A|IPAS|MOP7|PASD7
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 85kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQLELIGHSIF
Uniprot:: Q9Y2N7
Synonyms:: basic-helix-loop-helix-PAS protein MOP7;bHLHe17;class E basic helix-loop-helix protein 17;HIF-3A;HIF3-alpha-1;hypoxia inducible factor 3 alpha subunit;hypoxia-inducible factor 3-alpha;inhibitory PAS domain protein;IPAS;member of PAS protein 7;MOP7;PAS domain-containing protein 7;PASD7
Extra Details:: The protein encoded by this gene is the alpha-3 subunit of one of several alpha/beta-subunit heterodimeric transcription factors that regulate many adaptive responses to low oxygen tension (hypoxia). The alpha-3 subunit lacks the transactivation domain found in factors containing either the alpha-1 or alpha-2 subunits. It is thought that factors containing the alpha-3 subunit are negative regulators of hypoxia-inducible gene expression. Multiple alternatively spliced transcript variants have been found for this gene.