OGT Rabbit polyclonal antibody

Size

£152.00

SKU:: A1990
Additional Names:: HINCUT-1|HRNT1|MRX106|O-GLCNAC|OGT|OGT1|XLID106
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 110kDa/120kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYM
Uniprot:: O15294
Synonyms:: HINCUT-1;HRNT1;MRX106;O-GLCNAC;O-GlcNAc transferase p110 subunit;O-GlcNAc transferase subunit p110;O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase);O-linked N-acetylglucosamine transferase 110 kDa subunit;OGT1;UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit;UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase;uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase;XLID106
Extra Details:: This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Shipping Conditions:: Blue Ice