A1983
HSD17B2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1983
- Additional Names:
- EDH17B2|HSD17|HSD17B2|SDR9C2
- Application:
- ELISA, WB
- Molecular Weight:
- 35-40kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVT
- Uniprot:
- P37059
- Synonyms:
- 17-beta-HSD 2;17-beta-hydroxysteroid dehydrogenase type 2;20 alpha-hydroxysteroid dehydrogenase;20-alpha-HSD;E2DH;EDH17B2;estradiol 17-beta-dehydrogenase 2;HSD17;microsomal 17-beta-hydroxysteroid dehydrogenase;SDR9C2;short chain dehydrogenase/reductase family 9C member 2;testosterone 17-beta-dehydrogenase
- Extra Details:
- Enables estradiol 17-beta-dehydrogenase activity and testosterone dehydrogenase (NAD+) activity. Involved in response to retinoic acid. Predicted to be located in endoplasmic reticulum membrane.
- Shipping Conditions:
- Blue Ice

_WB_01.jpg)