TAB3 Rabbit monoclonal antibody

Size

POA

SKU:: A19824
Additional Names:: MAP3K7IP3|NAP1|TAB3
Application:: ELISA, WB
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHSPDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVH
Uniprot:: Q8N5C8
Synonyms:: MAP3K7IP3;mitogen-activated protein kinase kinase kinase 7 interacting protein 3;Mitogen-activated protein kinase kinase kinase 7-interacting protein 3;NAP1;NF-kappa-B-activating protein 1;NFkB activating protein 1;TAB-3;TAK1-binding protein 3;TGF-beta activated kinase 1 and MAP3K7 binding protein 3;TGF-beta-activated kinase 1 and MAP3K7-binding protein 3;TGF-beta-activated kinase 1-binding protein 3
Extra Details:: The product of this gene functions in the NF-kappaB signal transduction pathway. The encoded protein, and the similar and functionally redundant protein MAP3K7IP2/TAB2, forms a ternary complex with the protein kinase MAP3K7/TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent MAP3K7/TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. The human genome contains a related pseudogene. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Shipping Conditions:: Blue Ice