Histone H4 Rabbit monoclonal antibody

Size

POA

SKU:: A19815
Additional Names:: H4-16|H4/p|H4C1|H4C11|H4C12|H4C13|H4C14|H4C15|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|HIST4H4|Histone H4
Application:: ELISA, WB, IHC-P
Molecular Weight:: 11kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Uniprot:: P62805
Synonyms:: dJ160A22.1;dJ160A22.2;dJ221C16.1;dJ221C16.9;FO108;H4;H4 histone family, member A;H4 histone family, member B;H4 histone family, member C;H4 histone family, member D;H4 histone family, member E;H4 histone family, member G;H4 histone family, member H;H4 histone family, member I;H4 histone family, member J;H4 histone family, member K;H4 histone family, member M;H4 histone family, member N;H4 histone, family 2;H4-16;H4.k;H4/b;H4/c;H4/d;H4/e;H4/g;H4/h;H4/I;H4/j;H4/k;H4/m;H4/n;H4/o;H4/p;H4C1;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4F2;H4F2iii;H4F2iv;H4FA;H4FB;H4FC;H4FD;H4FE;H4FG;H4FH;H4FI;H4FJ;H4FK;H4FM;H4FN;H4M;HIST1H4A;HIST1H4B;HIST1H4C;HIST1H4D;HIST1H4E;HIST1H4F;HIST1H4H;HIST1H4I;HIST1H4J;HIST1H4K;HIST1H4L;HIST2H4;HIST2H4A;HIST2H4B;HIST4H4;histone 1, H4a;histone 1, H4b;histone 1, H4c;histone 1, H4d;histone 1, H4e;histone 1, H4f;histone 1, H4h;histone 1, H4i;histone 1, H4j;histone 1, H4k;histone 1, H4l;histone 2, H4a;histone 2, H4b;Histone 4 family, member M;histone 4, H4;histone cluster 1 H4 family member a;histone cluster 1 H4 family member b;histone cluster 1 H4 family member c;histone cluster 1 H4 family member d;histone cluster 1 H4 family member e;histone cluster 1 H4 family member f;histone cluster 1 H4 family member h;histone cluster 1 H4 family member i;histone cluster 1 H4 family member j;histone cluster 1 H4 family member k;histone cluster 1 H4 family member l;histone cluster 1, H4a;histone cluster 1, H4b;histone cluster 1, H4c;histone cluster 1, H4d;histone cluster 1, H4e;histone cluster 1, H4f;histone cluster 1, H4h;histone cluster 1, H4i;histone cluster 1, H4j;histone cluster 1, H4k;histone cluster 1, H4l;histone cluster 2 H4 family member a;histone cluster 2 H4 family member b;histone cluster 2, H4a;histone cluster 2, H4b;histone cluster 4 H4;histone family member;histone H4;histone IV, family 2
Extra Details:: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element.

Shipping Conditions:: Blue Ice