RIOX2/MINA53 Rabbit monoclonal antibody

Size

POA

SKU:: A19809
Additional Names:: JMJD10|MDIG|MINA|MINA53|NO52|RIOX2/MINA53|ROX
Application:: ELISA, WB
Molecular Weight:: 53kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LSTPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKE
Uniprot:: Q8IUF8
Synonyms:: 60S ribosomal protein L27a histidine hydroxylase;bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA;histone lysine demethylase MINA;JMJD10;MDIG;MINA;MINA53;mineral dust induced gene protein;Mineral dust-induced gene protein;MYC induced nuclear antigen;MYC-induced nuclear antigen;MYC-induced nuclear antigen 53;myc-induced nuclear antigen, 53 kDa;NO52;nucleolar protein 52;ribosomal oxygenase 2;ribosomal oxygenase MINA;ROX
Extra Details:: MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).