Neurogenin 2 Rabbit monoclonal antibody

Size

POA

SKU:: A19800
Additional Names:: Atoh4|bHLHa8|Math4A|Neurogenin 2|ngn-2|NGN2
Application:: ELISA, WB
Molecular Weight:: 29kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK
Uniprot:: Q9H2A3
Synonyms:: Atoh4;bHLHa8;class A basic helix-loop-helix protein 8;Math4A;neurogenin-2;ngn-2;NGN2;protein atonal homolog 4
Extra Details:: This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The protein product of this gene also plays a role in the differentiation and survival of midbrain dopaminergic neurons.