VPS11 Rabbit monoclonal antibody

Size

POA

SKU:: A19798
Additional Names:: DYT32|END1|HLD12|hVPS11|PEP5|RNF108|VPS11
Application:: ELISA, WB, IHC-P
Molecular Weight:: 108kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAYLQWRRFVFFDKELVKEPLSNDGAAPGATPASGSAASKFLCLPPGITVCDSGRGSLVFGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILA
Uniprot:: Q9H270
Synonyms:: END1;HLD12;hVPS11;PEP5;RING finger protein 108;RNF108;vacuolar protein sorting 11 homolog;vacuolar protein sorting-associated protein 11 homolog;VPS11, CORVET/HOPS core subunit
Extra Details:: Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps11 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. Alternative splicing results in multiple transcript variants.