A19795
Sec61A Rabbit monoclonal antibody
Size
POA
- SKU:
- A19795
- Additional Names:
- Sec61 alpha-2|Sec61A|SEC61A2
- Application:
- ELISA, WB
- Molecular Weight:
- 52kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SMGAIFEDPVHVVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTAAAFGGLCIGALSVLADFLGAIGSGTGILLA
- Uniprot:
- Q9H9S3
- Synonyms:
- protein transport protein Sec61 subunit alpha;protein transport protein Sec61 subunit alpha isoform 2;Sec61 alpha 2 subunit;Sec61 alpha form 2;sec61 alpha-2;SEC61 translocon alpha 2 subunit
- Extra Details:
- The protein encoded by this gene has similarity to a mouse protein which suggests a role in the insertion of secretory and membrane polypeptides into the endoplasmic reticulum. It may also be required for the assembly of membrane and secretory proteins. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice