A19792
ATAD2 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19792
- Additional Names:
- ANCCA|ATAD2|CT137|PRO2000
- Application:
- ELISA, WB
- Molecular Weight:
- 180kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLA
- Uniprot:
- Q6PL18
- Synonyms:
- AAA nuclear coregulator cancer-associated protein;ANCCA;ATPase family AAA domain-containing protein 2;CT137;PRO2000
- Extra Details:
- A large family of ATPases has been described, whose key feature is that they share a conserved region of about 220 amino acids that contains an ATP-binding site. The proteins that belong to this family either contain one or two AAA (ATPases Associated with diverse cellular Activities) domains. AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. The protein encoded by this gene contains two AAA domains, as well as a bromodomain.
- Shipping Conditions:
- Blue Ice