A19790
GOLPH4 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19790
- Additional Names:
- GIMPC|GOLPH4|GPP130|P138
- Application:
- ELISA, WB
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETL
- Uniprot:
- O00461
- Synonyms:
- 130 kDa golgi-localized phosphoprotein;cis Golgi-localized calcium-binding protein;GIMPC;Golgi integral membrane protein 4;golgi integral membrane protein, cis;golgi phosphoprotein 4;golgi phosphoprotein of 130 kDa;golgi-localized phosphoprotein of 130 kDa;GOLPH4;GPP130;P138;type II Golgi membrane protein
- Extra Details:
- The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.
- Shipping Conditions:
- Blue Ice