A19787
sestrin 1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19787
- Additional Names:
- PA26|SEST1|sestrin 1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 66kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAELV
- Uniprot:
- Q9Y6P5
- Synonyms:
- p53 activated gene 26;p53 regulated PA26 nuclear protein;p53-regulated protein PA26;PA26;SEST1;sestrin-1
- Extra Details:
- This gene encodes a member of the sestrin family. Sestrins are induced by the p53 tumor suppressor protein and play a role in the cellular response to DNA damage and oxidative stress. The encoded protein mediates p53 inhibition of cell growth by activating AMP-activated protein kinase, which results in the inhibition of the mammalian target of rapamycin protein. The encoded protein also plays a critical role in antioxidant defense by regenerating overoxidized peroxiredoxins, and the expression of this gene is a potential marker for exposure to radiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Shipping Conditions:
- Blue Ice