ZBTB7A/FBI-1/LRF Rabbit monoclonal antibody

Size

POA

SKU:: A19785
Additional Names:: FBI-1|FBI1|LRF|MNDLFH|pokemon|TIP21|ZBTB7|ZBTB7A/FBI-1/LRF|ZNF857A
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKDEDEDEDVASP
Uniprot:: O95365
Synonyms:: factor binding IST protein 1;factor that binds to inducer of short transcripts protein 1;FBI-1;FBI1;HIV-1 1st-binding protein 1;HIV-1 inducer of short transcripts binding protein;leukemia/lymphoma-related factor;LRF;lymphoma related factor;POK erythroid myeloid ontogenic factor;pokemon;pokemon 1;POZ and Krueppel erythroid myeloid ontogenic factor;TIP21;TTF-I-interacting peptide 21;ZBTB7;zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein;zinc finger and BTB domain-containing protein 7A;zinc finger protein 857A;ZNF857A
Extra Details:: Enables several functions, including SMAD binding activity; androgen receptor binding activity; and transcription corepressor binding activity. Involved in several processes, including erythrocyte maturation; negative regulation of signal transduction; and regulation of nucleobase-containing compound metabolic process. Located in cytoplasm and nucleus. Colocalizes with DNA-dependent protein kinase complex and NuRD complex.

Shipping Conditions:: Blue Ice