SUN2 Rabbit monoclonal antibody

Size

POA

SKU:: A19782
Additional Names:: rab5IP|SUN2|UNC84B
Application:: ELISA, WB, IHC-P
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH
Uniprot:: Q9UH99
Synonyms:: nuclear envelope protein;protein unc-84 homolog B;rab5-interacting protein;rab5IP;Sad1 unc-84 domain protein 2;sad1/unc-84 protein-like 2;SUN domain-containing protein 2;unc-84 homolog B;UNC84B
Extra Details:: SUN1 (MIM 607723) and SUN2 are inner nuclear membrane (INM) proteins that play a major role in nuclear-cytoplasmic connection by formation of a 'bridge' across the nuclear envelope, known as the LINC complex, via interaction with the conserved luminal KASH domain of nesprins (e.g., SYNE1; MIM 608441) located in the outer nuclear membrane (ONM). The LINC complex provides a direct connection between the nuclear lamina and the cytoskeleton, which contributes to nuclear positioning and cellular rigidity (summary by Haque et al., 2010 [PubMed 19933576]).