PHF8 Rabbit monoclonal antibody

Size

POA

SKU:: A19780
Additional Names:: JHDM1F|KDM7B|MRXSSD|PHF8|ZNF422
Application:: ELISA, WB
Molecular Weight:: 140kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TVSNSPASQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGT
Uniprot:: Q9UPP1
Synonyms:: [histone H3]-dimethyl-L-lysine(36) demethylase PHF8;[histone H3]-dimethyl-L-lysine(9) demethylase PHF8;histone lysine demethylase PHF8;JHDM1F;jumonji C domain-containing histone demethylase 1F;KDM7B;MRXSSD;PHD finger protein 8;ZNF422
Extra Details:: The protein encoded by this gene is a histone lysine demethylase that preferentially acts on histones in the monomethyl or dimethyl states. The encoded protein requires Fe(2+) ion, 2-oxoglutarate, and oxygen for its catalytic activity. The protein has an N-terminal PHD finger and a central Jumonji C domain. This gene is thought to function as a transcription activator. Defects in this gene are a cause of syndromic X-linked Siderius type intellectual disability (MRXSSD) and over-expression of this gene is associated with several forms of cancer. Multiple transcript variants encoding different isoforms have been found for this gene.