A19772
Destrin Rabbit monoclonal antibody
Size
POA
- SKU:
- A19772
- Additional Names:
- ACTDP|ADF|bA462D18.2|Destrin|HEL32
- Application:
- ELISA, WB
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELM
- Uniprot:
- P60981
- Synonyms:
- ACTDP;actin-depolymerizing factor;ADF;bA462D18.2;bA462D18.2 (destrin (actin depolymerizing factor ADF) (ACTDP));destrin;epididymis luminal protein 32;epididymis secretory sperm binding protein;HEL32
- Extra Details:
- The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene.
- Shipping Conditions:
- Blue Ice