A19749
Rad21 Rabbit monoclonal antibody
Size
POA
- SKU:
- A19749
- Additional Names:
- CDLS4|hHR21|HR21|HRAD21|MCD1|MGS|NXP1|Rad21|SCC1
- Application:
- ChIP, ELISA, WB
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII
- Uniprot:
- O60216
- Synonyms:
- CDLS4;double-strand-break repair protein rad21 homolog;hHR21;HR21;HRAD21;kleisin;MCD1;MGS;nuclear matrix protein 1;NXP-1;NXP1;protein involved in DNA double-strand break repair;RAD21 homolog;SCC1;SCC1 homolog;sister chromatid cohesion 1
- Extra Details:
- The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells.
- Shipping Conditions:
- Blue Ice