IK KappaBA Alpha Rabbit monoclonal antibody

Size

POA

SKU:: A19714
Additional Names:: EDAID2|IKBA|IK KappaBA Alpha|MAD-3|NFKBI
Application:: ELISA, WB, IHC-P
Molecular Weight:: 40 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGD
Uniprot:: P25963
Synonyms:: EDAID2;I-kappa-B-alpha;IkappaBalpha;ikB-alpha;IKBA;MAD-3;major histocompatibility complex enhancer-binding protein MAD3;NF-kappa-B inhibitor alpha;NFKBI;nuclear factor of kappa light chain gene enhancer in B-cells;nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha
Extra Details:: This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease.