Hippocalcin (HPCA) Rabbit monoclonal antibody

Size

POA

SKU:: A19696
Additional Names:: BDR2|DYT2|Hippocalcin (HPCA)
Application:: ELISA, WB
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQK
Uniprot:: P84074
Synonyms:: BDR2;calcium-binding protein BDR-2;dystonia 2, torsion (autosomal recessive);DYT2;neuron-specific calcium-binding protein hippocalcin
Extra Details:: The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. This protein is associated with the plasma membrane. It has similarities to proteins located in the photoreceptor cells that regulate photosignal transduction in a calcium-sensitive manner. This protein displays recoverin activity and a calcium-dependent inhibition of rhodopsin kinase. It is identical to the rat and mouse hippocalcin proteins and thought to play an important role in neurons of the central nervous system in a number of species.