[KO Validated] cIAP1 Rabbit monoclonal antibody

Size

POA

SKU:: A19688
Additional Names:: API1|c-IAP1|cIAP1|Hiap-2|HIAP2|MIHB|P1|RNF48
Application:: ELISA, WB, IHC-P
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPI
Uniprot:: Q13490
Synonyms:: API1;apoptosis inhibitor 1;baculoviral IAP repeat-containing protein 2;c-IAP1;cellular inhibitor of apoptosis 1;cIAP1;Hiap-2;HIAP2;IAP homolog B;IAP-2;inhibitor of apoptosis protein 2;MIHB;NFR2-TRAF signalling complex protein;RING finger protein 48;RING-type E3 ubiquitin transferase BIRC2;RNF48;TNFR2-TRAF-signaling complex protein 2
Extra Details:: The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.