GABA A Receptor beta 1 (GABRB1) Rabbit monoclonal antibody

Size

POA

SKU:: A19681
Additional Names:: DEE45|EIEE45|GABA A Receptor beta 1 (GABRB1)
Application:: ELISA, WB
Molecular Weight:: 54kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTDVNSID
Uniprot:: P18505
Synonyms:: DEE45;EIEE45;GABA(A) receptor subunit beta-1;gamma-aminobutyric acid (GABA) A receptor, beta 1;gamma-aminobutyric acid receptor subunit beta-1;gamma-aminobutyric acid type A receptor beta1 subunit
Extra Details:: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 1 subunit. It is mapped to chromosome 4p12 in a cluster comprised of genes encoding alpha 4, alpha 2 and gamma 1 subunits of the GABA A receptor. Alteration of this gene is implicated in the pathogenetics of schizophrenia.