Cathepsin D Rabbit monoclonal antibody

Size

POA

SKU:: A19680
Additional Names:: Cathepsin D|CLN10|CPSD|HEL-S-130P
Application:: ELISA, WB, IHC-P
Molecular Weight:: 28kDa/44kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Uniprot:: P07339
Synonyms:: cathepsin D;ceroid-lipofuscinosis, neuronal 10;CLN10;CPSD;epididymis secretory sperm binding protein Li 130P;HEL-S-130P;lysosomal aspartyl peptidase;lysosomal aspartyl protease
Extra Details:: This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease.