A19679
[KD Validated] DNMT1 Rabbit monoclonal antibody

Size
POA
- SKU:
- A19679
- Additional Names:
- [KD Validated] DNMT1|ADCADN|AIM|CXXC9|DNMT|HSN1E|m.HsaI|MCMT
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 200kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN
- Uniprot:
- P26358
- Synonyms:
- ADCADN;AIM;CXXC-type zinc finger protein 9;CXXC9;DNA (cytosine-5-)-methyltransferase 1;DNA (cytosine-5)-methyltransferase 1;DNA methyltransferase HsaI;DNA MTase HsaI;DNMT;HSN1E;m.HsaI;MCMT
- Extra Details:
- This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice
![[KD Validated] DNMT1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19679/A19679_1.jpg)
![[KD Validated] DNMT1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19679/A19679_2.jpg)
![[KD Validated] DNMT1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19679/A19679_3.jpg)
![[KD Validated] DNMT1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19679/A19679_ARC51348-01_WB_02.jpg)
![[KD Validated] DNMT1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19679/A19679_ARC51348-01_KO-WB_01.jpg)
![[KD Validated] DNMT1 Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19679/A19679_ARC51348-01_IP_01.jpg)