[KD Validated] DNMT1 Rabbit monoclonal antibody

Size

POA

SKU:: A19679
Additional Names:: [KD Validated] DNMT1|ADCADN|AIM|CXXC9|DNMT|HSN1E|m.HsaI|MCMT
Application:: ELISA, WB, IP
Molecular Weight:: 200kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN
Uniprot:: P26358
Synonyms:: ADCADN;AIM;CXXC-type zinc finger protein 9;CXXC9;DNA (cytosine-5-)-methyltransferase 1;DNA (cytosine-5)-methyltransferase 1;DNA methyltransferase HsaI;DNA MTase HsaI;DNMT;HSN1E;m.HsaI;MCMT
Extra Details:: This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.