[KD Validated] LC3B Rabbit monoclonal antibody

Size

POA

SKU:: A19665
Additional Names:: 3B|ATG8F|LC3B|MAP1A/1BLC3|MAP1LC3B-a
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 14 kDa/16 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDG
Uniprot:: Q9GZQ8
Synonyms:: ATG8F;Autophagy-related protein LC3 B;autophagy-related ubiquitin-like modifier LC3 B;LC3B;MAP1 light chain 3-like protein 2;MAP1A/1BLC3;MAP1A/MAP1B LC3 B;MAP1A/MAP1B light chain 3 B;MAP1LC3B-a;Microtubule-associated protein 1 light chain 3 beta;microtubule-associated proteins 1A/1B light chain 3B
Extra Details:: The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.