[KO Validated] DNMT3A Rabbit monoclonal antibody

Size

POA

SKU:: A19659
Additional Names:: 3A|DNMT3A2|HESJAS|M.HsaIIIA|TBRS
Application:: ELISA, WB
Molecular Weight:: 130kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVL
Uniprot:: Q9Y6K1
Synonyms:: cysteine methyltransferase DNMT3A;DNA (cytosine-5-)-methyltransferase 3 alpha;DNA (cytosine-5)-methyltransferase 3A;DNA cytosine methyltransferase 3A2;DNA methyltransferase HsaIIIA;DNA MTase HsaIIIA;DNMT3A2;HESJAS;M.HsaIIIA;TBRS
Extra Details:: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.