A19655
Versican Rabbit monoclonal antibody

Size
POA
- SKU:
- A19655
- Additional Names:
- CSPG2|ERVR|GHAP|PG-M|Versican|WGN|WGN1
- Application:
- ELISA, WB
- Molecular Weight:
- 373kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR
- Uniprot:
- P13611
- Synonyms:
- chondroitin sulfate proteoglycan core protein 2;CSPG2;ERVR;GHAP;glial hyaluronate-binding protein;large fibroblast proteoglycan;PG-M;versican core protein;versican proteoglycan;WGN;WGN1
- Extra Details:
- This gene is a member of the aggrecan/versican proteoglycan family. The protein encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. Mutations in this gene are the cause of Wagner syndrome type 1. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice




